HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5U9U6

Names and origin
Entry : A5U9U6 (reviewed)
Entry name : IF1_HAEIE
Protein names : Translation initiation factor IF-1
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : infA
ORF names : CGSHiEE_00245
History
Date of creation : 2008-06-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; translation initiation factor activity
GO identifier : GO:0005737; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis
General annotation
Domains : S1-like domain (1)
Sequence similarities : Belongs to IF-1 family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 80 residues
>A5U9U6|IF1_HAEIE Haemophilus influenzae PittEE
MAKEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPY
DLSKGRIIFRSR