EDB - Ebola Database

Protein search results for - Q05320

Names and origin
Entry : Q05320 (reviewed)
Entry name : VGP_EBOZM
Protein names : Envelope glycoprotein (GP1,2) (GP) [Cleaved into: GP1; GP2; GP2-delta]
Organism : Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
Organism ID : 128952
Gene names : GP
History
Date of creation : 1994-02-01
Date of modification : 2014-11-26
Date of sequence modification : 1994-02-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : clathrin-mediated endocytosis of virus by host cell; cytoplasm; fusion of virus membrane with host endosome membrane; host cell endoplasmic reticulum; host cell plasma membrane; integral component of membrane; membrane raft; suppression by virus of host tetherin activity; suppression by virus of host type I interferon-mediated signaling pathway; viral budding from plasma membrane; viral entry into host cell; viral envelope; virion attachment to host cell
GO identifier : GO:0075512; GO:0005737; GO:0039654; GO:0044165; GO:0020002; GO:0016021; GO:0045121; GO:0039587; GO:0039502; GO:0046761; GO:0046718; GO:0019031; GO:0019062
Keywords
Ligand & Biological process : 3D-structure; Clathrin-mediated endocytosis of virus by host; Cleavage on pair of basic residues; Coiled coil; Complete proteome; Disulfide bond; Fusion of virus membrane with host endosomal membrane; Fusion of virus membrane with host membrane; Glycoprotein; Host cell membrane; Host membrane; Host-virus interaction; Inhibition of host innate immune response by virus; Inhibition of host interferon signaling pathway by virus; Inhibition of host tetherin by virus; Lipoprotein; Membrane; Palmitate; RNA editing; Reference proteome; Secreted; Signal; Transmembrane; Transmembrane helix; Viral attachment to host cell; Viral envelope protein; Viral immunoevasion; Viral penetration into host cytoplasm; Virion; Virus endocytosis by host; Virus entry into host cell
General annotation
Domains : The mucin-like region seems to be involved in the cytotoxic function. This region is also involved in binding to human CLEC10A.; The coiled coil regions play a role in oligomerization and fusion activity.
Sequence similarities : Belongs to Filoviruses glycoprotein family
Subcellular location : GP2: Virion membrane; Single-pass type I membrane
Reference
PubMed ID : 8237108; 8553543; 8622982; 11062045; 1299611; 9576958; 9614872; 9499027; 10482652; 9882347; 10932225; 11112476; 11152533; 11024148; 11461707; 12438572; 11836430; 11877482; 12050398; 14645601; 12504546; 15103332; 14990712; 16051836; 15831716; 15681442; 155
Protein sequence
Length : 724 residues
>Q05320|VGP_EBOZM Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSST
NQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSE
CLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGV
VAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLT
YVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRK
IRSEELSFTVVSNGAKNISGQSPARTSSDPGTNTTTEDHKIMASENSSAMVQVHSQGREA
AVSHLTTLATISTSPQSLTTKPGPDNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDT
PSATTAAGPPKAENTNTSKSTDFLDPATTTSPQNHSETAGNNNTHHQDTGEESASSGKLG
LITNTIAGVAGLITGGRRTRREAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAE
GIYIEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGT
CHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPDQGDNDNWWTGWRQWIPAGIGVTG
VIIAVIALFCICKFVF