EDB - Ebola Database

  Protein search results for - Q66810

Names and origin
Entry : Q66810 (reviewed)
Entry name : VGP_TAFVC
Protein names : Envelope glycoprotein (GP1,2) (GP) [Cleaved into: GP1; GP2; GP2-delta]
Organism : Tai Forest ebolavirus (strain Cote d'Ivoire-94) (TAFV) (Cote d'Ivoire Ebola virus)
Organism ID : 128999
Gene names : GP
History
Date of creation : 2000-05-30
Date of modification : 2014-10-29
Date of sequence modification : 1996-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : clathrin-mediated endocytosis of virus by host cell; fusion of virus membrane with host endosome membrane; host cell plasma membrane; integral component of membrane; suppression by virus of host tetherin activity; suppression by virus of host type I interferon-mediated signaling pathway; viral envelope; virion attachment to host cell
GO identifier : GO:0075512; GO:0039654; GO:0020002; GO:0016021; GO:0039587; GO:0039502; GO:0019031; GO:0019062
Keywords
Ligand & Biological process : Clathrin-mediated endocytosis of virus by host; Cleavage on pair of basic residues; Coiled coil; Disulfide bond; Fusion of virus membrane with host endosomal membrane; Fusion of virus membrane with host membrane; Glycoprotein; Host cell membrane; Host membrane; Host-virus interaction; Inhibition of host innate immune response by virus; Inhibition of host interferon signaling pathway by virus; Inhibition of host tetherin by virus; Lipoprotein; Membrane; Palmitate; RNA editing; Secreted; Signal; Transmembrane; Transmembrane helix; Viral attachment to host cell; Viral envelope protein; Viral immunoevasion; Viral penetration into host cytoplasm; Virion; Virus endocytosis by host; Virus entry into host cell
General annotation
Domains : The mucin-like region seems to be involved in the cytotoxic function. This region is also involved in binding to human CLEC10A (By similarity). {ECO:0000250}.; The coiled coil regions play a role in oligomerization and fusion activity. {ECO:0000250}.
Sequence similarities : Belongs to Filoviruses glycoprotein family
Subcellular location : GP2: Virion membrane {ECO:0000250}; Single-pass ty
Reference
PubMed ID : 8622982; 14990712
Protein sequence
Length : 724 residues
>Q66810|VGP_TAFVC Tai Forest ebolavirus (strain Cote d'Ivoire-94) (TAFV) (Cote d'Ivoire Ebola virus)
MGASGILQLPRERFRKTSFFVWVIILFHKVFSIPLGVVHNNTLQVSDIDKFVCRDKLSST
SQLKSVGLNLEGNGVATDVPTATKRWGFRAGVPPKVVNYEAGEWAENCYNLAIKKVDGSE
CLPEAPEGVRDFPRCRYVHKVSGTGPCPGGLAFHKEGAFFLYDRLASTIIYRGTTFAEGV
IAFLILPKARKDFFQSPPLHEPANMTTDPSSYYHTTTINYVVDNFGTNTTEFLFQVDHLT
YVQLEARFTPQFLVLLNETIYSDNRRSNTTGKLIWKINPTVDTSMGEWAFWENKKNFTKT
LSSEELSFVPVPETQNQVLDTTATVSPPISAHNHAGEDHKELVSEDSTPVVQMQNIKGKD
TMPTTVTGVPTTTPSPFPINARNTDHTKSFIGLEGPQEDHSTTQPAKTTSQPTNSTESTT
LNPTSEPSSRGTGPSSPTVPNTTESHAELGKTTPTTLPEQHTAASAIPRAVHPDELSGPG
FLTNTIRGVTNLLTGSRRKRRDVTPNTQPKCNPNLHYWTALDEGAAIGLAWIPYFGPAAE
GIYTEGIMENQNGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGT
CHILGPDCCIEPQDWTKNITDKIDQIIHDFVDNNLPNQNDGSNWWTGWKQWVPAGIGITG
VIIAIIALLCICKFML