EDB - Ebola Database

  Protein search results for - Q66538

Names and origin
Entry : Q66538 (unreviewed)
Entry name : Q66538_9MONO
Protein names : Zaire Ebola virus 3' proximal protein (Fragment)
Organism : Zaire ebolavirus
Organism ID : 186538
History
Date of creation : 1996-11-01
Date of modification : 2014-11-26
Date of sequence modification : 1996-11-01
Protein attributes
Protein existence : Predicted
Sequence status : fragment
Reference
PubMed ID : 3946083
Protein sequence
Length : 39 residues
>Q66538|Q66538_9MONO Zaire ebolavirus
MRKINNFLSLKFDDRNLKLKLLICNHTVDSEPHTS