EDB: Ebola Database

Protein search results for - Q2PDK5

Names and origin

Entry	:	Q2PDK5 (reviewed)
Entry name	:	VP40_EBOG4
Protein names	:	Matrix protein VP40 (Membrane-associated protein VP40)
Organism	:	Zaire ebolavirus (strain Gabon-94) (ZEBOV) (Zaire Ebola virus)
Organism ID	:	128947
Gene names	:	VP40

History

Date of creation	:	2006-07-11
Date of modification	:	2014-10-29
Date of sequence modification	:	2006-02-07

Protein attributes

Protein existence

Evidence at transcript level

Gene Ontology (GO)

GO term name	:	host cell plasma membrane; membrane; ribonucleoprotein complex; RNA binding; structural constituent of virion; viral budding via host ESCRT complex; viral release from host cell; virion
GO identifier	:	GO:0003723; GO:0020002; GO:0016020; GO:0030529; GO:0039660; GO:0039702; GO:0019076; GO:0019012

Keywords

Ligand & Biological process

Host cell membrane; Host membrane; Host-virus interaction; Membrane; RNA-binding; Ribonucleoprotein; Viral RNA replication; Viral budding; Viral budding via the host ESCRT complexes; Viral matrix protein; Virion; Virus exit from host cell

General annotation

Domains	:	Late-budding domains (L domains) are short sequence motifs essential for viral particle budding. They recruit proteins of the host ESCRT machinery (Endosomal Sorting Complex Required for Transport) or ESCRT-associated proteins. VP40 contains two overlapping L domains: a PTAP/PSAP motif, which interacts with the UEV domain of TSG101 and a PPXY motif which interacts with the WW domain 3 of NEDD4.
Sequence similarities	:	Belongs to Filoviridae matrix protein VP40 family
Subcellular location	:	Virion membrane {ECO:0000250}; Peripheral membrane

Reference

PubMed ID

11752702

Protein sequence

Length

350 residues

>Q2PDK5|VP40_EBOG4 Zaire ebolavirus (strain Gabon-94) (ZEBOV) (Zaire Ebola virus)
MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTID
HASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASY
TITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALK
LITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTFPEKIQAI
MTSLQDLKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAP
GDLTMVITQDCDTCHSPASLPAVIEK