EDB - Ebola Database

  Protein search results for - Q05128

Names and origin
Entry : Q05128 (reviewed)
Entry name : VP40_EBOZM
Protein names : Matrix protein VP40 (Membrane-associated protein VP40)
Organism : Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
Organism ID : 128952
Gene names : VP40
History
Date of creation : 1994-02-01
Date of modification : 2014-11-26
Date of sequence modification : 1994-02-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : host cell plasma membrane; integral to membrane of host cell; membrane raft; ribonucleoprotein complex; RNA binding; structural constituent of virion; suppression of host defenses; viral budding from plasma membrane; viral budding via host ESCRT complex; virion
GO identifier : GO:0003723; GO:0020002; GO:0044385; GO:0045121; GO:0030529; GO:0039660; GO:0044414; GO:0046761; GO:0039702; GO:0019012
Keywords
Ligand & Biological process : 3D-structure; Complete proteome; Host cell membrane; Host membrane; Host-virus interaction; Membrane; RNA-binding; Reference proteome; Ribonucleoprotein; Viral RNA replication; Viral budding; Viral budding via the host ESCRT complexes; Viral matrix protein; Virion; Virus exit from host cell
General annotation
Domains : Late-budding domains (L domains) are short sequence motifs essential for viral particle budding. They recruit proteins of the host ESCRT machinery (Endosomal Sorting Complex Required for Transport) or ESCRT-associated proteins. VP40 contains two overlapping L domains: a PTAP/PSAP motif, which interacts with the UEV domain of TSG101 and a PPXY motif which interacts with the WW domain 3 of NEDD4.
Sequence similarities : Belongs to Filoviridae matrix protein VP40 family
Subcellular location : Virion membrane; Peripheral membrane protein. Host
Reference
PubMed ID : 8482365; 8237108; 10073695; 11062045; 11118208; 11095724; 12919741; 12559917; 16051823; 15908231; 15650213; 15892969; 16719918; 16698994; 17229682; 17699576; 12679020
Protein sequence
Length : 350 residues
>Q05128|VP40_EBOZM Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTID
HASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASY
TITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALK
LITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAI
MTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAP
GDLTMVITQDCDTCHSPASLPAVIEK