EDB - Ebola Database

  Protein search results for - Q05127

Names and origin
Entry : Q05127 (reviewed)
Entry name : VP35_EBOZM
Protein names : Polymerase cofactor VP35
Organism : Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
Organism ID : 128952
Gene names : VP35
History
Date of creation : 1994-02-01
Date of modification : 2014-11-26
Date of sequence modification : 1994-02-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : evasion or tolerance by virus of host immune response; host cell cytoplasm; negative regulation of gene expression; negative regulation of gene silencing by miRNA; ribonucleoprotein complex; RNA binding; suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II; suppression by virus of host cytokine production; suppression by virus of host IKBKE activity; suppression by virus of host IRF3 activity by inhibition of IRF3 phosphorylation; suppression by virus of host IRF7 activity by positive regulation of IRF7 sumoylation; suppression by virus of host TBK1 activity; suppression by virus of host toll-like receptor signaling pathway; suppression by virus of host type I interferon production; suppression of host defenses; transcription, DNA-templated; viral nucleocapsid
GO identifier : GO:0003723; GO:0030683; GO:0030430; GO:0010629; GO:0060965; GO:0030529; GO:0039724; GO:0039549; GO:0039558; GO:0039723; GO:0039505; GO:0046775; GO:0039722; GO:0039501; GO:0044414; GO:0006351; GO:0019013
Binary interactions
Entry : O75569
Keywords
Ligand & Biological process : 3D-structure; Coiled coil; Complete proteome; Host cytoplasm; Host-virus interaction; Inhibition of host IKBKE by virus; Inhibition of host IRF7 by virus; Inhibition of host RLR pathway by virus; Inhibition of host TBK1 by virus; Inhibition of host TLR pathway by virus; Inhibition of host innate immune response by virus; Interferon antiviral system evasion; RNA-binding; Reference proteome; Transcription; Viral RNA replication; Viral immunoevasion; Virion
General annotation
Sequence similarities : Belongs to Filoviridae polymerase cofactor VP35 family
Subcellular location : Virion. Host cytoplasm.
Reference
PubMed ID : 8482365; 8237108; 10073695; 11062045; 9971816; 11027311; 12191476; 12829834; 15464838; 16095644; 16698997; 16698994; 16495261; 17065211; 19153231
Protein sequence
Length : 364 residues
>Q05127|VP35_EBOZM Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
MTTRTKGRGHTAATTQNDRMPGPELSGWISEQLMTGRIPVSDIFCDIENNPGLCYASQMQ
QTKPNPKTRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKP
VYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATEAYWAEHGQPPPGPSLYEESA
IRGKIESRDETVPQSVREAFNNLNSTTSLTEENFGKPDISAKDLRNIMYDHLPGFGTAFH
QLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSR
GDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI