EDB - Ebola Database

  Protein search results for - A0EJG2

Names and origin
Entry : A0EJG2 (unreviewed)
Entry name : A0EJG2_9MONO
Protein names : Polymerase (Fragment)
Organism : Zaire ebolavirus
Organism ID : 186538
Gene names : L
History
Date of creation : 2006-11-28
Date of modification : 2014-10-29
Date of sequence modification : 2006-11-28
Protein attributes
Protein existence : Predicted
Sequence status : fragment
Gene Ontology (GO)
GO term name : ATP binding; mRNA (guanine-N7-)-methyltransferase activity; RNA-directed RNA polymerase activity; virion
GO identifier : GO:0005524; GO:0003968; GO:0004482; GO:0019012
Reference
PubMed ID : 17069458
Protein sequence
Length : 110 residues
>A0EJG2|A0EJG2_9MONO Zaire ebolavirus
NVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATVRGSSFVT
DLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCY